Precio por envase (10 viales). El descuento se aplica únicamente a este compuesto; no se admiten combinaciones.
| 5 mg | ||
|---|---|---|
| Cantidad | Precio por paquete | Ahorros |
| 1 paquete | 325 dólares por paquete | |
| 2 paquetes | 276 dólares por paquete | 15 % de descuento |
| 3 paquetes | $235 per pack | 28 % de descuento |
| 5 paquetes | 211 dólares por paquete | 35 % de descuento |
| 10 paquetes | $190 per pack | 42 % de descuento |
| 25 paquetes | $171 per pack | 47 % de descuento |
LL-37 — Human Cathelicidin Antimicrobial Peptide | Innate Immune Defense & Immunomodulator
LL-37 is the sole member of the human cathelicidin family — a 37-amino acid cationic, amphipathic peptide derived from the C-terminal domain of the precursor protein hCAP18, encoded by the CAMP gene. It is released from neutrophils, macrophages, keratinocytes, and epithelial cells in response to infection or tissue injury, and represents the first-line peptide defense of the human innate immune system. Unlike conventional antimicrobials that act through a single enzymatic mechanism, LL-37 is fundamentally pleiotropic: it disrupts bacterial membranes through direct physical pore formation, neutralizes bacterial endotoxins (LPS and LTA), recruits and activates immune cells, promotes angiogenesis, accelerates wound re-epithelialization, and modulates both pro- and anti-inflammatory signaling — all through a compact helical structure of 37 amino acids with a net positive charge of +6.
Why LL-37’s Multi-Receptor Profile Defines Its Research Utility
LL-37’s defining feature as a research tool is its capacity to engage an unusually broad range of cellular targets from a single endogenous molecule. Most antimicrobial agents act on pathogens alone; LL-37 simultaneously acts on pathogens, immune cells, epithelial cells, endothelial cells, and connective tissue — making it a uniquely powerful probe for studying the intersection of innate immunity, inflammation, and tissue regeneration.
Its cationic amphipathic α-helical structure allows it to electrostatically target negatively charged bacterial membrane components (LPS in Gram-negatives; lipoteichoic acids in Gram-positives), insert into the lipid bilayer, and form oligomeric pores that disrupt membrane integrity and cause rapid bacterial cell death — a mechanism that remains effective against multidrug-resistant strains including MRSA, VRE, and resistant Klebsiella due to its physical, non-receptor-mediated mechanism of action.
Beyond direct antimicrobial killing, LL-37 engages host-cell receptors driving immunomodulatory and regenerative cascades:
| Target / Pathway | Research Effect |
|---|---|
| Formyl Peptide Receptor 2 (FPR2/FPRL-1) | Chemoattraction of neutrophils, monocytes, and T cells; modulation of neutrophil apoptosis |
| Purinergic Receptor P2X7 | Stimulates IL-1β secretion from monocytes; promotes intracellular pathogen clearance |
| Epidermal Growth Factor Receptor (EGFR) | Transactivation → keratinocyte migration and proliferation → wound re-epithelialization |
| VEGF / Angiogenic Signaling | Promotes new blood vessel formation to support tissue regeneration and wound perfusion |
| TLR4 / LPS Neutralization | Binds and sequesters lipopolysaccharide, dampening endotoxin-driven systemic inflammation |
| NF-κB / Cytokine Modulation | Context-dependent pro- and anti-inflammatory effects; suppresses IFN-γ, TNF-α, IL-4, IL-12 in specific models while upregulating CXCL8 for neutrophil recruitment |
| pDC / TLR9 Signaling | Complexes with self-DNA to activate plasmacytoid dendritic cells; relevant to autoimmunity research models |
| IGF-1R / MAPK-ERK | Secondary cross-activation reported in oncology-adjacent signaling studies |
This breadth of receptor engagement — across both pathogen-directed and host-directed pathways — distinguishes LL-37 from any single-mechanism antimicrobial or anti-inflammatory compound, and is why it has entered clinical trials for chronic wound healing, diabetic ulcers, and intratumoral injection in melanoma.
Aplicaciones de investigación
LL-37 is used in studies examining:
Especificaciones
| Formato | Polvo liofilizado |
| Pureza | ≥99% |
| Alias | CAP-18 C-terminal peptide, hCAP18/LL-37, Human Cathelicidin |
| Sequence | [LL-37, 37 aa] |
| Amino Acids | 37 |
| Net Charge | +6 (cationic) |
| Molecular Weight | ~4,493 Da |
| Available Size | 5 mg |
| Almacenamiento | 2–8°C unopened; stable 2+ years |
| Uso | Solo para fines de investigación — No apto para uso humano |
Reconstitución
LL-37 arrives as lyophilized powder and is reconstituted with bacteriostatic water prior to use. Add bacteriostatic water slowly by directing the stream against the inside wall of the vial — do not inject directly onto the peptide cake. Gently swirl to dissolve; do not shake. LL-37’s amphipathic helical structure can self-associate at higher concentrations, so gentle handling during reconstitution preserves monomeric/active fractions.
Total en mg ÷ Volumen añadido (mL) = Concentración (mg/mL)
Example: 5mg + 3mL BAC water = 1.67mg/mL — each 0.1mL = 167mcg Example: 5mg + 2.5mL BAC water = 2mg/mL — each 0.1mL = 200mcg Example: 5mg + 5mL BAC water = 1mg/mL — each 0.1mL = 100mcg
Reconstituted LL-37 should be stored at 2–8°C and used within 28–30 days. The lyophilized peptide is stable for 2+ years when kept at or below 2–8°C, away from light and moisture.
Notas sobre el protocolo
LL-37 research is conducted via subcutaneous injection in systemic immune and tissue-repair models, or topically in wound healing studies. Unlike long-half-life growth factors, LL-37’s effects are partially immediate (membrane disruption, immune cell recruitment) and partially sustained (angiogenesis, re-epithelialization), so injection frequency varies by research endpoint. Cycling is not required for receptor desensitization reasons, but study durations are typically endpoint-specific.
Typical research dosing framework:
Efectos observados con frecuencia en modelos de investigación:
LL-37 is commonly paired in research settings with:
Garantía de pureza
Cada lote tiene una pureza ≥99 %. Si sometes tu compuesto a un análisis independiente y los resultados no coinciden, envíanos el certificado de análisis (COA) y te concederemos un vale de compra sin hacerte preguntas.



